Recombinant Human soluble CD40 Ligand
(rHusCD40L)
Catalog Number: C22-103-06
Source: Escherichia coli.
Molecular Weight: Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.
Quantity: 10μg/50μg/1000μg
AA Sequence: MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY
AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ
PGASVFVNVT DPSQVSHGTG FTSFGLLKL
Purity: >95% by SDS-PAGE and HPLC analyses.
Biological Activity: Fully biologically active when compared to standard. The ED50 determined by a cell proliferation
assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml, corresponding to a specific activity of＞ 3.3 × 102 IU/mg in the presence of 20ng/ml rHuIL4.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.0.
Endotoxin: Less than 1EU/μg of rHusCD40L as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a
concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and
stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage,
preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For
maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to
-70°C. Avoid repeated freeze/thaw cycles.
Usage: This material is offered by Shanghai Corning Bio-Tech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Human soluble CD40 Ligand
CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging
to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells,
like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its murine counterpart.
The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed
on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of
soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through
oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities
on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion
and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell
maturation.
