Recombinant Human Fibroblast Growth Factor- acidic
(rHuaFGF)
Catalog Number: C22-104-01
Source: Escherichia coli.
Molecular Weight: Approximately 15.8 kDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
Quantity: 10μg/50μg/1000μg
AA Sequence: MFNLPPGNYK KPKLLYCSNG GHFLRILPDG TVDGTRDRSD QHIQLQLSAE SVGEVYIKST
ETGQYLAMDTDGLLYGSQTPNEECLFLERL EENHYNTYIS KKHAEKNWFV GLKKNGSCKR
GPRTHYGQKA ILFLPLPVSS D
Purity: >95% by SDS-PAGE and HPLC analyses.
Biological Activity: Fully biologically active when compared to standard. The ED50 determined by a cell proliferation
assay using murine NR6R/3T3 cells is less than 0.3 ng/ml, corresponding to a specific activity of＞ 3.3 × 106 IU/mg in the presence of 10μg/ml of heparin.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Endotoxin: Less than 1EU/μg of rHuaFGF as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the
bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a
concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and
stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage,
preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For
maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to
-70°C. Avoid repeated freeze/thaw cycles.
Usage: This material is offered by Shanghai Corning Bio-Tech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Human Fibroblast Growth Factor-acidic
Fibroblast Growth Factor-acidic (FGF acidic), also known as FGF-1 and endothelial cell growth factor, is a member of the FGF
family of mitogenic peptides which currently is comprised of at least seven proteins which show 35-55% amino acid sequence
conservation. FGF acidic and basic, unlike the other members of the family, lack signal peptides and are apparently secreted by
mechanisms other than the classical protein secretion pathway. FGF acidic has been detected in large amounts in the brain. Other
cells known to express FGF acidic include hepatocytes, vascular smooth muscle cells, CNS neurons, skeletal muscle cells,
fibroblasts, keratinocytes, endothelial cells, intestinal columnar epithelium cells and pituitary basophils and acidophils. As with
other FGF’s, FGF acidic exhibits considerable species crossreactivity. FGF acidic and FGF basic stimulate the proliferation of all
cells of mesodermal origin, and many cells of neuroectodermal, ectodermal and endodermal origin.
